Icon representing a puzzle

2240: Revisiting Puzzle 59: TCR Binding Protein

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
December 16, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Team South Africa 11. Team South Africa 1 pt. 9,032
  2. Avatar for Ogre's lab 12. Ogre's lab 1 pt. 8,868
  3. Avatar for Team China 13. Team China 1 pt. 8,842
  4. Avatar for BBIO WARRIOR 14. BBIO WARRIOR 1 pt. 8,815
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 2,942
  1. Avatar for user939700 81. user939700 Lv 1 1 pt. 8,704
  2. Avatar for eve 82. eve Lv 1 1 pt. 8,703
  3. Avatar for JRCAP 83. JRCAP Lv 1 1 pt. 8,699
  4. Avatar for Gnny18 84. Gnny18 Lv 1 1 pt. 8,680
  5. Avatar for Swapper242 85. Swapper242 Lv 1 1 pt. 8,651
  6. Avatar for JerryIson_ 86. JerryIson_ Lv 1 1 pt. 8,646
  7. Avatar for MA_MAHUSAY 87. MA_MAHUSAY Lv 1 1 pt. 8,645
  8. Avatar for Sophia Dominique Amihan 88. Sophia Dominique Amihan Lv 1 1 pt. 8,645
  9. Avatar for futsall 89. futsall Lv 1 1 pt. 8,624
  10. Avatar for Jazza Nova Gonzales 90. Jazza Nova Gonzales Lv 1 1 pt. 8,615

Comments