Icon representing a puzzle

2240: Revisiting Puzzle 59: TCR Binding Protein

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
December 16, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,159
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 10,128
  3. Avatar for Void Crushers 3. Void Crushers 47 pts. 10,046
  4. Avatar for Contenders 4. Contenders 30 pts. 10,037
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 10,002
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 10,001
  7. Avatar for Gargleblasters 7. Gargleblasters 7 pts. 9,894
  8. Avatar for AlphaFold 8. AlphaFold 4 pts. 9,689
  9. Avatar for Australia 9. Australia 2 pts. 9,653
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 9,638
  1. Avatar for user939700 81. user939700 Lv 1 1 pt. 8,704
  2. Avatar for eve 82. eve Lv 1 1 pt. 8,703
  3. Avatar for JRCAP 83. JRCAP Lv 1 1 pt. 8,699
  4. Avatar for Gnny18 84. Gnny18 Lv 1 1 pt. 8,680
  5. Avatar for Swapper242 85. Swapper242 Lv 1 1 pt. 8,651
  6. Avatar for JerryIson_ 86. JerryIson_ Lv 1 1 pt. 8,646
  7. Avatar for MA_MAHUSAY 87. MA_MAHUSAY Lv 1 1 pt. 8,645
  8. Avatar for Sophia Dominique Amihan 88. Sophia Dominique Amihan Lv 1 1 pt. 8,645
  9. Avatar for futsall 89. futsall Lv 1 1 pt. 8,624
  10. Avatar for Jazza Nova Gonzales 90. Jazza Nova Gonzales Lv 1 1 pt. 8,615

Comments