Icon representing a puzzle

2243: Revisiting Puzzle 60: Beta Barrel

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
December 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,882
  2. Avatar for Go Science 2. Go Science 68 pts. 12,556
  3. Avatar for Contenders 3. Contenders 44 pts. 12,503
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 27 pts. 12,458
  5. Avatar for Void Crushers 5. Void Crushers 16 pts. 12,230
  6. Avatar for Gargleblasters 6. Gargleblasters 9 pts. 12,124
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 12,113
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 12,039
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 12,030
  10. Avatar for Team China 10. Team China 1 pt. 11,778
  1. Avatar for spmm 11. spmm Lv 1 50 pts. 12,230
  2. Avatar for Punzi Baker 3 12. Punzi Baker 3 Lv 1 47 pts. 12,205
  3. Avatar for Galaxie 13. Galaxie Lv 1 43 pts. 12,197
  4. Avatar for grogar7 14. grogar7 Lv 1 40 pts. 12,194
  5. Avatar for blazegeek 15. blazegeek Lv 1 37 pts. 12,186
  6. Avatar for Joanna_H 16. Joanna_H Lv 1 34 pts. 12,124
  7. Avatar for christioanchauvin 17. christioanchauvin Lv 1 32 pts. 12,113
  8. Avatar for Bletchley Park 18. Bletchley Park Lv 1 29 pts. 12,097
  9. Avatar for ucad 19. ucad Lv 1 27 pts. 12,047
  10. Avatar for fpc 20. fpc Lv 1 25 pts. 12,039

Comments