Icon representing a puzzle

2243: Revisiting Puzzle 60: Beta Barrel

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
December 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,882
  2. Avatar for Go Science 2. Go Science 68 pts. 12,556
  3. Avatar for Contenders 3. Contenders 44 pts. 12,503
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 27 pts. 12,458
  5. Avatar for Void Crushers 5. Void Crushers 16 pts. 12,230
  6. Avatar for Gargleblasters 6. Gargleblasters 9 pts. 12,124
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 12,113
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 12,039
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 12,030
  10. Avatar for Team China 10. Team China 1 pt. 11,778
  1. Avatar for Gonegirl 71. Gonegirl Lv 1 1 pt. 10,776
  2. Avatar for mart0258 72. mart0258 Lv 1 1 pt. 10,773
  3. Avatar for Swapper242 73. Swapper242 Lv 1 1 pt. 10,604
  4. Avatar for robgee 74. robgee Lv 1 1 pt. 10,598
  5. Avatar for pruneau_44 75. pruneau_44 Lv 1 1 pt. 10,516
  6. Avatar for Crossed Sticks 76. Crossed Sticks Lv 1 1 pt. 10,365
  7. Avatar for Sammy3c2b1a0 77. Sammy3c2b1a0 Lv 1 1 pt. 10,346
  8. Avatar for greg_marconnet 78. greg_marconnet Lv 1 1 pt. 5,496

Comments