Icon representing a puzzle

2243: Revisiting Puzzle 60: Beta Barrel

Closed since about 3 years ago

Novice Overall Prediction

Summary


Created
December 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,882
  2. Avatar for Go Science 2. Go Science 68 pts. 12,556
  3. Avatar for Contenders 3. Contenders 44 pts. 12,503
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 27 pts. 12,458
  5. Avatar for Void Crushers 5. Void Crushers 16 pts. 12,230
  6. Avatar for Gargleblasters 6. Gargleblasters 9 pts. 12,124
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 12,113
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 12,039
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 12,030
  10. Avatar for Team China 10. Team China 1 pt. 11,778

  1. Avatar for harvardman 51. harvardman Lv 1 1 pt. 11,295
  2. Avatar for Oransche 52. Oransche Lv 1 1 pt. 11,288
  3. Avatar for TgamesPi 53. TgamesPi Lv 1 1 pt. 11,274
  4. Avatar for AlkiP0Ps 54. AlkiP0Ps Lv 1 1 pt. 11,268
  5. Avatar for zbp 55. zbp Lv 1 1 pt. 11,251
  6. Avatar for versat82 56. versat82 Lv 1 1 pt. 11,246
  7. Avatar for carxo 57. carxo Lv 1 1 pt. 11,233
  8. Avatar for fiendish_ghoul 58. fiendish_ghoul Lv 1 1 pt. 11,190
  9. Avatar for Wiz kid 59. Wiz kid Lv 1 1 pt. 11,186
  10. Avatar for rinze 60. rinze Lv 1 1 pt. 11,138

Comments