Icon representing a puzzle

2243: Revisiting Puzzle 60: Beta Barrel

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
December 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,882
  2. Avatar for Go Science 2. Go Science 68 pts. 12,556
  3. Avatar for Contenders 3. Contenders 44 pts. 12,503
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 27 pts. 12,458
  5. Avatar for Void Crushers 5. Void Crushers 16 pts. 12,230
  6. Avatar for Gargleblasters 6. Gargleblasters 9 pts. 12,124
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 12,113
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 12,039
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 12,030
  10. Avatar for Team China 10. Team China 1 pt. 11,778
  1. Avatar for Dr.Sillem 61. Dr.Sillem Lv 1 1 pt. 11,134
  2. Avatar for Savas 62. Savas Lv 1 1 pt. 11,131
  3. Avatar for DScott 63. DScott Lv 1 1 pt. 10,979
  4. Avatar for Bollo 64. Bollo Lv 1 1 pt. 10,973
  5. Avatar for Larini 65. Larini Lv 1 1 pt. 10,957
  6. Avatar for Mohoernchen 66. Mohoernchen Lv 1 1 pt. 10,913
  7. Avatar for futsall 67. futsall Lv 1 1 pt. 10,911
  8. Avatar for froschi2 68. froschi2 Lv 1 1 pt. 10,896
  9. Avatar for heyubob 69. heyubob Lv 1 1 pt. 10,867
  10. Avatar for frostschutz 70. frostschutz Lv 1 1 pt. 10,815

Comments