Icon representing a puzzle

Beginner Puzzle: Easy Mini Freestyle

Closed since about 3 years ago

Beginner

Summary

Created
December 29, 2022
Expires
Max points
100
Description

We are giving you this currently unsolved short protein as an extended chain. It has only 48 residues and we're posting it with no secondary structure predictions. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
STMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK

Top groups

  1. Avatar for OmHS
    1. OmHS
    100 pts. 7,267
  2. Avatar for Street Smarts 2. Street Smarts 14 pts. 6,325
  3. Avatar for Villanova ChE 3. Villanova ChE 1 pt. 6,211
  4. Avatar for CHEM1210/1020 TTU 4. CHEM1210/1020 TTU 1 pt. 5,480
  1. Avatar for Kaja_2001 11. Kaja_2001 Lv 1 34 pts. 6,996
  2. Avatar for keikoutou 12. keikoutou Lv 1 30 pts. 6,537
  3. Avatar for fabia.l 13. fabia.l Lv 1 27 pts. 6,447
  4. Avatar for ritch 14. ritch Lv 1 23 pts. 6,443
  5. Avatar for wudie 15. wudie Lv 1 21 pts. 6,340
  6. Avatar for Jinshuo Li 16. Jinshuo Li Lv 1 18 pts. 6,325
  7. Avatar for emm 17. emm Lv 1 16 pts. 6,322
  8. Avatar for mkweon 18. mkweon Lv 1 14 pts. 6,305
  9. Avatar for iestrandson 19. iestrandson Lv 1 12 pts. 6,287
  10. Avatar for frnclsh 20. frnclsh Lv 1 10 pts. 6,271

Comments