Icon representing a puzzle

Beginner Puzzle: Easy Mini Freestyle

Closed since about 3 years ago

Beginner

Summary

Created
December 29, 2022
Expires
Max points
100
Description

We are giving you this currently unsolved short protein as an extended chain. It has only 48 residues and we're posting it with no secondary structure predictions. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
STMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK

Top groups

  1. Avatar for OmHS
    1. OmHS
    100 pts. 7,267
  2. Avatar for Street Smarts 2. Street Smarts 14 pts. 6,325
  3. Avatar for Villanova ChE 3. Villanova ChE 1 pt. 6,211
  4. Avatar for CHEM1210/1020 TTU 4. CHEM1210/1020 TTU 1 pt. 5,480
  1. Avatar for amakedon
    1. amakedon Lv 1
    100 pts. 8,290
  2. Avatar for Evolve7696 2. Evolve7696 Lv 1 91 pts. 8,068
  3. Avatar for BrittanyBird 3. BrittanyBird Lv 1 82 pts. 7,843
  4. Avatar for RaiyneV 4. RaiyneV Lv 1 74 pts. 7,554
  5. Avatar for adnanm4 5. adnanm4 Lv 1 67 pts. 7,513
  6. Avatar for Kayceecyr65 6. Kayceecyr65 Lv 1 60 pts. 7,267
  7. Avatar for Porus 7. Porus Lv 1 54 pts. 7,247
  8. Avatar for mttl1mutation 8. mttl1mutation Lv 1 48 pts. 7,182
  9. Avatar for kittycatcaoimhe 9. kittycatcaoimhe Lv 1 43 pts. 7,150
  10. Avatar for BeatEmlikeBreezy 10. BeatEmlikeBreezy Lv 1 38 pts. 7,029

Comments