Beginner Puzzle: Easy Mini Freestyle

Closed since about 3 years ago

Summary

• Created: December 29, 2022
• Expires: February 09, 2023 at 23:00 UTC
• Max points: 100

Description

We are giving you this currently unsolved short protein as an extended chain. It has only 48 residues and we're posting it with no secondary structure predictions. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

• Sequence: STMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK

Top groups

• 1. OmHS 100 pts. 7,267
• 2. Street Smarts 14 pts. 6,325
• 3. Villanova ChE 1 pt. 6,211
• 4. CHEM1210/1020 TTU 1 pt. 5,480

Top soloists

• 51. zariora 1 pt. 0
• 52. kim118 1 pt. 0