Icon representing a puzzle

Beginner Puzzle: Easy Mini Freestyle

Closed since about 3 years ago

Beginner

Summary

Created
December 29, 2022
Expires
Max points
100
Description

We are giving you this currently unsolved short protein as an extended chain. It has only 48 residues and we're posting it with no secondary structure predictions. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
STMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK

Top groups

  1. Avatar for OmHS
    1. OmHS
    100 pts. 7,267
  2. Avatar for Street Smarts 2. Street Smarts 14 pts. 6,325
  3. Avatar for Villanova ChE 3. Villanova ChE 1 pt. 6,211
  4. Avatar for CHEM1210/1020 TTU 4. CHEM1210/1020 TTU 1 pt. 5,480
  1. Avatar for Wenny_007 21. Wenny_007 Lv 1 9 pts. 6,252
  2. Avatar for gamipreet98 22. gamipreet98 Lv 1 8 pts. 6,252
  3. Avatar for 3C Kitani 23. 3C Kitani Lv 1 6 pts. 6,249
  4. Avatar for Hwy47 24. Hwy47 Lv 1 5 pts. 6,214
  5. Avatar for Yani8592 25. Yani8592 Lv 1 5 pts. 6,211
  6. Avatar for Patel.foram 26. Patel.foram Lv 1 4 pts. 6,194
  7. Avatar for 2023SpringSarahKateMiller 27. 2023SpringSarahKateMiller Lv 1 3 pts. 5,480
  8. Avatar for chall18 28. chall18 Lv 1 3 pts. 5,475
  9. Avatar for jbussell 29. jbussell Lv 1 2 pts. 5,432
  10. Avatar for agao123 30. agao123 Lv 1 2 pts. 5,420

Comments