Icon representing a puzzle

2256: Revisiting Puzzle 64: Thioredoxin

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
January 25, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 11,258
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 10,877
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,735
  4. Avatar for PFMD 14. PFMD 1 pt. 9,999
  1. Avatar for Bletchley Park 11. Bletchley Park Lv 1 51 pts. 11,652
  2. Avatar for g_b 12. g_b Lv 1 48 pts. 11,650
  3. Avatar for dcrwheeler 13. dcrwheeler Lv 1 44 pts. 11,642
  4. Avatar for fpc 14. fpc Lv 1 41 pts. 11,640
  5. Avatar for Kiwegapa 15. Kiwegapa Lv 1 38 pts. 11,632
  6. Avatar for guineapig 16. guineapig Lv 1 35 pts. 11,618
  7. Avatar for spmm 17. spmm Lv 1 33 pts. 11,614
  8. Avatar for phi16 18. phi16 Lv 1 30 pts. 11,611
  9. Avatar for BootsMcGraw 19. BootsMcGraw Lv 1 28 pts. 11,600
  10. Avatar for WBarme1234 20. WBarme1234 Lv 1 26 pts. 11,599

Comments