Icon representing a puzzle

2256: Revisiting Puzzle 64: Thioredoxin

Closed since over 3 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 25, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Go Science 100 pts. 11,807
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 11,765
  3. Avatar for Void Crushers 3. Void Crushers 44 pts. 11,696
  4. Avatar for Contenders 4. Contenders 27 pts. 11,694
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 11,640
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 11,599
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 11,556
  8. Avatar for Gargleblasters 8. Gargleblasters 3 pts. 11,455
  9. Avatar for Australia 9. Australia 1 pt. 11,407
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 11,297

  1. Avatar for Bletchley Park 11. Bletchley Park Lv 1 51 pts. 11,652
  2. Avatar for g_b 12. g_b Lv 1 48 pts. 11,650
  3. Avatar for dcrwheeler 13. dcrwheeler Lv 1 44 pts. 11,642
  4. Avatar for fpc 14. fpc Lv 1 41 pts. 11,640
  5. Avatar for Kiwegapa 15. Kiwegapa Lv 1 38 pts. 11,632
  6. Avatar for guineapig 16. guineapig Lv 1 35 pts. 11,618
  7. Avatar for spmm 17. spmm Lv 1 33 pts. 11,614
  8. Avatar for phi16 18. phi16 Lv 1 30 pts. 11,611
  9. Avatar for BootsMcGraw 19. BootsMcGraw Lv 1 28 pts. 11,600
  10. Avatar for WBarme1234 20. WBarme1234 Lv 1 26 pts. 11,599

Comments