Icon representing a puzzle

2256: Revisiting Puzzle 64: Thioredoxin

Closed since about 3 years ago

Novice Overall Prediction

Summary


Created
January 25, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 11,258
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 10,877
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,735
  4. Avatar for PFMD 14. PFMD 1 pt. 9,999

  1. Avatar for Mohoernchen 71. Mohoernchen Lv 1 1 pt. 10,830
  2. Avatar for zbp 72. zbp Lv 1 1 pt. 10,794
  3. Avatar for elv 73. elv Lv 1 1 pt. 10,787
  4. Avatar for alyssa_d_V2.0 74. alyssa_d_V2.0 Lv 1 1 pt. 10,735
  5. Avatar for Swapper242 75. Swapper242 Lv 1 1 pt. 10,725
  6. Avatar for Sammy3c2b1a0 76. Sammy3c2b1a0 Lv 1 1 pt. 10,691
  7. Avatar for asw2022 77. asw2022 Lv 1 1 pt. 9,999
  8. Avatar for scotj14 78. scotj14 Lv 1 1 pt. 7,731
  9. Avatar for britanym 79. britanym Lv 1 1 pt. 7,731
  10. Avatar for georg137 80. georg137 Lv 1 1 pt. 7,731

Comments