Icon representing a puzzle

2265: Revisiting Puzzle 68: Bos Taurus

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
February 15, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Marvin's bunch 11. Marvin's bunch 1 pt. 10,397
  2. Avatar for CureCoin 12. CureCoin 1 pt. 9,531
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,518
  4. Avatar for Goons with proteins 14. Goons with proteins 1 pt. 9,019
  1. Avatar for maithra 31. maithra Lv 1 13 pts. 10,313
  2. Avatar for stomjoh 32. stomjoh Lv 1 12 pts. 10,284
  3. Avatar for blazegeek 33. blazegeek Lv 1 11 pts. 10,280
  4. Avatar for Silvercraft 34. Silvercraft Lv 1 10 pts. 10,253
  5. Avatar for ProfVince 35. ProfVince Lv 1 10 pts. 10,244
  6. Avatar for fpc 36. fpc Lv 1 9 pts. 10,211
  7. Avatar for fiendish_ghoul 37. fiendish_ghoul Lv 1 8 pts. 10,210
  8. Avatar for heather-1 38. heather-1 Lv 1 7 pts. 10,159
  9. Avatar for rosie4loop 39. rosie4loop Lv 1 7 pts. 10,100
  10. Avatar for Wiz kid 40. Wiz kid Lv 1 6 pts. 10,067

Comments