Icon representing a puzzle

2265: Revisiting Puzzle 68: Bos Taurus

Closed since over 3 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 15, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,750
  2. Avatar for Go Science 2. Go Science 68 pts. 10,722
  3. Avatar for Contenders 3. Contenders 44 pts. 10,623
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 27 pts. 10,599
  5. Avatar for Void Crushers 5. Void Crushers 16 pts. 10,597
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,568
  7. Avatar for Australia 7. Australia 5 pts. 10,517
  8. Avatar for OmHS 8. OmHS 3 pts. 10,480
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 10,443
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 10,406

  1. Avatar for maithra 31. maithra Lv 1 13 pts. 10,313
  2. Avatar for stomjoh 32. stomjoh Lv 1 12 pts. 10,284
  3. Avatar for blazegeek 33. blazegeek Lv 1 11 pts. 10,280
  4. Avatar for Silvercraft 34. Silvercraft Lv 1 10 pts. 10,253
  5. Avatar for ProfVince 35. ProfVince Lv 1 10 pts. 10,244
  6. Avatar for fpc 36. fpc Lv 1 9 pts. 10,211
  7. Avatar for fiendish_ghoul 37. fiendish_ghoul Lv 1 8 pts. 10,210
  8. Avatar for heather-1 38. heather-1 Lv 1 7 pts. 10,159
  9. Avatar for rosie4loop 39. rosie4loop Lv 1 7 pts. 10,100
  10. Avatar for Wiz kid 40. Wiz kid Lv 1 6 pts. 10,067

Comments