Icon representing a puzzle

2265: Revisiting Puzzle 68: Bos Taurus

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
February 15, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Marvin's bunch 11. Marvin's bunch 1 pt. 10,397
  2. Avatar for CureCoin 12. CureCoin 1 pt. 9,531
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,518
  4. Avatar for Goons with proteins 14. Goons with proteins 1 pt. 9,019
  1. Avatar for ucad 51. ucad Lv 1 2 pts. 9,869
  2. Avatar for sitlux 52. sitlux Lv 1 2 pts. 9,855
  3. Avatar for carxo 53. carxo Lv 1 2 pts. 9,801
  4. Avatar for abiogenesis 54. abiogenesis Lv 1 2 pts. 9,775
  5. Avatar for manu8170 55. manu8170 Lv 1 1 pt. 9,745
  6. Avatar for Larini 56. Larini Lv 1 1 pt. 9,693
  7. Avatar for Dr.Sillem 57. Dr.Sillem Lv 1 1 pt. 9,676
  8. Avatar for DScott 58. DScott Lv 1 1 pt. 9,661
  9. Avatar for zbp 59. zbp Lv 1 1 pt. 9,581
  10. Avatar for frostschutz 60. frostschutz Lv 1 1 pt. 9,575

Comments