Icon representing a puzzle

2265: Revisiting Puzzle 68: Bos Taurus

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
February 15, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,750
  2. Avatar for Go Science 2. Go Science 68 pts. 10,722
  3. Avatar for Contenders 3. Contenders 44 pts. 10,623
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 27 pts. 10,599
  5. Avatar for Void Crushers 5. Void Crushers 16 pts. 10,597
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,568
  7. Avatar for Australia 7. Australia 5 pts. 10,517
  8. Avatar for OmHS 8. OmHS 3 pts. 10,480
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 10,443
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 10,406
  1. Avatar for ucad 51. ucad Lv 1 2 pts. 9,869
  2. Avatar for sitlux 52. sitlux Lv 1 2 pts. 9,855
  3. Avatar for carxo 53. carxo Lv 1 2 pts. 9,801
  4. Avatar for abiogenesis 54. abiogenesis Lv 1 2 pts. 9,775
  5. Avatar for manu8170 55. manu8170 Lv 1 1 pt. 9,745
  6. Avatar for Larini 56. Larini Lv 1 1 pt. 9,693
  7. Avatar for Dr.Sillem 57. Dr.Sillem Lv 1 1 pt. 9,676
  8. Avatar for DScott 58. DScott Lv 1 1 pt. 9,661
  9. Avatar for zbp 59. zbp Lv 1 1 pt. 9,581
  10. Avatar for frostschutz 60. frostschutz Lv 1 1 pt. 9,575

Comments