Icon representing a puzzle

2265: Revisiting Puzzle 68: Bos Taurus

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
February 15, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Marvin's bunch 11. Marvin's bunch 1 pt. 10,397
  2. Avatar for CureCoin 12. CureCoin 1 pt. 9,531
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,518
  4. Avatar for Goons with proteins 14. Goons with proteins 1 pt. 9,019
  1. Avatar for Kiwegapa 61. Kiwegapa Lv 1 1 pt. 9,574
  2. Avatar for Oransche 62. Oransche Lv 1 1 pt. 9,564
  3. Avatar for kotenok2000 63. kotenok2000 Lv 1 1 pt. 9,531
  4. Avatar for ShadowTactics 64. ShadowTactics Lv 1 1 pt. 9,518
  5. Avatar for Alistair69 65. Alistair69 Lv 1 1 pt. 9,511
  6. Avatar for rezaefar 66. rezaefar Lv 1 1 pt. 9,372
  7. Avatar for RWoodcock 67. RWoodcock Lv 1 1 pt. 9,326
  8. Avatar for B. A. Beder 68. B. A. Beder Lv 1 1 pt. 9,261
  9. Avatar for Dorane 69. Dorane Lv 1 1 pt. 9,257
  10. Avatar for Merf 70. Merf Lv 1 1 pt. 9,247

Comments