Icon representing a puzzle

2265: Revisiting Puzzle 68: Bos Taurus

Closed since about 3 years ago

Novice Overall Prediction

Summary


Created
February 15, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,750
  2. Avatar for Go Science 2. Go Science 68 pts. 10,722
  3. Avatar for Contenders 3. Contenders 44 pts. 10,623
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 27 pts. 10,599
  5. Avatar for Void Crushers 5. Void Crushers 16 pts. 10,597
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,568
  7. Avatar for Australia 7. Australia 5 pts. 10,517
  8. Avatar for OmHS 8. OmHS 3 pts. 10,480
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 10,443
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 10,406

  1. Avatar for Kiwegapa 61. Kiwegapa Lv 1 1 pt. 9,574
  2. Avatar for Oransche 62. Oransche Lv 1 1 pt. 9,564
  3. Avatar for kotenok2000 63. kotenok2000 Lv 1 1 pt. 9,531
  4. Avatar for ShadowTactics 64. ShadowTactics Lv 1 1 pt. 9,518
  5. Avatar for Alistair69 65. Alistair69 Lv 1 1 pt. 9,511
  6. Avatar for rezaefar 66. rezaefar Lv 1 1 pt. 9,372
  7. Avatar for RWoodcock 67. RWoodcock Lv 1 1 pt. 9,326
  8. Avatar for B. A. Beder 68. B. A. Beder Lv 1 1 pt. 9,261
  9. Avatar for Dorane 69. Dorane Lv 1 1 pt. 9,257
  10. Avatar for Merf 70. Merf Lv 1 1 pt. 9,247

Comments