Icon representing a puzzle

2265: Revisiting Puzzle 68: Bos Taurus

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
February 15, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Marvin's bunch 11. Marvin's bunch 1 pt. 10,397
  2. Avatar for CureCoin 12. CureCoin 1 pt. 9,531
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,518
  4. Avatar for Goons with proteins 14. Goons with proteins 1 pt. 9,019
  1. Avatar for WuWTq 81. WuWTq Lv 1 1 pt. 8,708
  2. Avatar for DipsyDoodle2016 82. DipsyDoodle2016 Lv 1 1 pt. 8,376
  3. Avatar for greengrass 83. greengrass Lv 1 1 pt. 7,984
  4. Avatar for phi16 84. phi16 Lv 1 1 pt. 7,936
  5. Avatar for moony 85. moony Lv 1 1 pt. 7,915
  6. Avatar for edahay23 86. edahay23 Lv 1 1 pt. 5,671
  7. Avatar for prooh 87. prooh Lv 1 1 pt. 4,858
  8. Avatar for kommuni 88. kommuni Lv 1 1 pt. 4,858
  9. Avatar for spark69! 89. spark69! Lv 1 1 pt. 4,858
  10. Avatar for Johnny-Boi 90. Johnny-Boi Lv 1 1 pt. 4,858

Comments