Icon representing a puzzle

2265: Revisiting Puzzle 68: Bos Taurus

Closed since about 3 years ago

Novice Overall Prediction

Summary


Created
February 15, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,750
  2. Avatar for Go Science 2. Go Science 68 pts. 10,722
  3. Avatar for Contenders 3. Contenders 44 pts. 10,623
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 27 pts. 10,599
  5. Avatar for Void Crushers 5. Void Crushers 16 pts. 10,597
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,568
  7. Avatar for Australia 7. Australia 5 pts. 10,517
  8. Avatar for OmHS 8. OmHS 3 pts. 10,480
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 10,443
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 10,406

  1. Avatar for WuWTq 81. WuWTq Lv 1 1 pt. 8,708
  2. Avatar for DipsyDoodle2016 82. DipsyDoodle2016 Lv 1 1 pt. 8,376
  3. Avatar for greengrass 83. greengrass Lv 1 1 pt. 7,984
  4. Avatar for phi16 84. phi16 Lv 1 1 pt. 7,936
  5. Avatar for moony 85. moony Lv 1 1 pt. 7,915
  6. Avatar for edahay23 86. edahay23 Lv 1 1 pt. 5,671
  7. Avatar for prooh 87. prooh Lv 1 1 pt. 4,858
  8. Avatar for kommuni 88. kommuni Lv 1 1 pt. 4,858
  9. Avatar for spark69! 89. spark69! Lv 1 1 pt. 4,858
  10. Avatar for Johnny-Boi 90. Johnny-Boi Lv 1 1 pt. 4,858

Comments