Icon representing a puzzle

2285: Revisiting Puzzle 74: Platypus Venom

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
April 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 8,467
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 8,413
  3. Avatar for SP26 CHEM 351 Weldon 13. SP26 CHEM 351 Weldon 1 pt. 7,892
  4. Avatar for Q3 - Bioteknologi Protein 14. Q3 - Bioteknologi Protein 1 pt. 7,859
  5. Avatar for SHELL 15. SHELL 1 pt. 5,961
  1. Avatar for ucad 41. ucad Lv 1 6 pts. 8,802
  2. Avatar for hada 42. hada Lv 1 6 pts. 8,761
  3. Avatar for antibot215 43. antibot215 Lv 1 5 pts. 8,720
  4. Avatar for AlphaFold2 44. AlphaFold2 Lv 1 5 pts. 8,700
  5. Avatar for georg137 45. georg137 Lv 1 4 pts. 8,660
  6. Avatar for DScott 46. DScott Lv 1 4 pts. 8,645
  7. Avatar for Jackd4w 47. Jackd4w Lv 1 3 pts. 8,639
  8. Avatar for abiogenesis 48. abiogenesis Lv 1 3 pts. 8,628
  9. Avatar for NPrincipi 49. NPrincipi Lv 1 3 pts. 8,603
  10. Avatar for sitlux 50. sitlux Lv 1 3 pts. 8,600

Comments