Icon representing a puzzle

2285: Revisiting Puzzle 74: Platypus Venom

Closed since about 3 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for Go Science 100 pts. 9,732
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 9,673
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 47 pts. 9,611
  4. Avatar for Contenders 4. Contenders 30 pts. 9,505
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 9,481
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 9,344
  7. Avatar for Australia 7. Australia 7 pts. 9,246
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 9,217
  9. Avatar for AlphaFold 9. AlphaFold 2 pts. 8,700
  10. Avatar for VeFold 10. VeFold 1 pt. 8,478

  1. Avatar for ucad 41. ucad Lv 1 6 pts. 8,802
  2. Avatar for hada 42. hada Lv 1 6 pts. 8,761
  3. Avatar for antibot215 43. antibot215 Lv 1 5 pts. 8,720
  4. Avatar for AlphaFold2 44. AlphaFold2 Lv 1 5 pts. 8,700
  5. Avatar for georg137 45. georg137 Lv 1 4 pts. 8,660
  6. Avatar for DScott 46. DScott Lv 1 4 pts. 8,645
  7. Avatar for Jackd4w 47. Jackd4w Lv 1 3 pts. 8,639
  8. Avatar for abiogenesis 48. abiogenesis Lv 1 3 pts. 8,628
  9. Avatar for NPrincipi 49. NPrincipi Lv 1 3 pts. 8,603
  10. Avatar for sitlux 50. sitlux Lv 1 3 pts. 8,600

Comments