Icon representing a puzzle

2285: Revisiting Puzzle 74: Platypus Venom

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
April 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,732
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 9,673
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 47 pts. 9,611
  4. Avatar for Contenders 4. Contenders 30 pts. 9,505
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 9,481
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 9,344
  7. Avatar for Australia 7. Australia 7 pts. 9,246
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 9,217
  9. Avatar for AlphaFold 9. AlphaFold 2 pts. 8,700
  10. Avatar for VeFold 10. VeFold 1 pt. 8,478
  1. Avatar for drumpeter18yrs9yrs 11. drumpeter18yrs9yrs Lv 1 56 pts. 9,526
  2. Avatar for MicElephant 12. MicElephant Lv 1 53 pts. 9,505
  3. Avatar for gmn 13. gmn Lv 1 50 pts. 9,502
  4. Avatar for Galaxie 14. Galaxie Lv 1 47 pts. 9,496
  5. Avatar for drjr 15. drjr Lv 1 44 pts. 9,489
  6. Avatar for WBarme1234 16. WBarme1234 Lv 1 41 pts. 9,481
  7. Avatar for phi16 17. phi16 Lv 1 39 pts. 9,468
  8. Avatar for BootsMcGraw 18. BootsMcGraw Lv 1 36 pts. 9,442
  9. Avatar for Bletchley Park 19. Bletchley Park Lv 1 34 pts. 9,439
  10. Avatar for maithra 20. maithra Lv 1 32 pts. 9,430

Comments