Icon representing a puzzle

2285: Revisiting Puzzle 74: Platypus Venom

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
April 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,732
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 9,673
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 47 pts. 9,611
  4. Avatar for Contenders 4. Contenders 30 pts. 9,505
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 9,481
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 9,344
  7. Avatar for Australia 7. Australia 7 pts. 9,246
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 9,217
  9. Avatar for AlphaFold 9. AlphaFold 2 pts. 8,700
  10. Avatar for VeFold 10. VeFold 1 pt. 8,478
  1. Avatar for Wanderer09 51. Wanderer09 Lv 1 2 pts. 8,597
  2. Avatar for Deleted player 52. Deleted player 2 pts. 8,573
  3. Avatar for Dr.Sillem 53. Dr.Sillem Lv 1 2 pts. 8,508
  4. Avatar for RichGuilmain 54. RichGuilmain Lv 1 2 pts. 8,498
  5. Avatar for carxo 55. carxo Lv 1 2 pts. 8,478
  6. Avatar for kitsoune 56. kitsoune Lv 1 1 pt. 8,477
  7. Avatar for ShadowTactics 57. ShadowTactics Lv 1 1 pt. 8,467
  8. Avatar for zbp 58. zbp Lv 1 1 pt. 8,437
  9. Avatar for Trajan464 59. Trajan464 Lv 1 1 pt. 8,423
  10. Avatar for alyssa_d_V2.0 60. alyssa_d_V2.0 Lv 1 1 pt. 8,413

Comments