Placeholder image of a protein
Icon representing a puzzle

2293: Electron Density Reconstruction 37

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
April 21, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This one has two copies of the same protein in it.

Sequence
CSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNE SLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGF

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 31,503
  2. Avatar for Go Science 2. Go Science 68 pts. 31,371
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 31,135
  4. Avatar for Contenders 4. Contenders 27 pts. 31,115
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 31,044
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 30,998
  7. Avatar for Australia 7. Australia 5 pts. 30,581
  8. Avatar for BOINC@Poland 8. BOINC@Poland 3 pts. 30,156
  9. Avatar for VeFold 9. VeFold 1 pt. 30,049
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 28,773
  1. Avatar for g_b 21. g_b Lv 1 27 pts. 30,922
  2. Avatar for Steven Pletsch 22. Steven Pletsch Lv 1 25 pts. 30,861
  3. Avatar for alcor29 23. alcor29 Lv 1 23 pts. 30,657
  4. Avatar for equilibria 24. equilibria Lv 1 21 pts. 30,655
  5. Avatar for Wanderer09 25. Wanderer09 Lv 1 20 pts. 30,643
  6. Avatar for AlkiP0Ps 26. AlkiP0Ps Lv 1 18 pts. 30,581
  7. Avatar for toshiue 27. toshiue Lv 1 17 pts. 30,554
  8. Avatar for phi16 28. phi16 Lv 1 15 pts. 30,450
  9. Avatar for manu8170 29. manu8170 Lv 1 14 pts. 30,428
  10. Avatar for Flagg65a 30. Flagg65a Lv 1 13 pts. 30,423

Comments