Placeholder image of a protein
Icon representing a puzzle

2293: Electron Density Reconstruction 37

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
April 21, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This one has two copies of the same protein in it.

Sequence
CSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNE SLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGF

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 31,503
  2. Avatar for Go Science 2. Go Science 68 pts. 31,371
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 31,135
  4. Avatar for Contenders 4. Contenders 27 pts. 31,115
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 31,044
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 30,998
  7. Avatar for Australia 7. Australia 5 pts. 30,581
  8. Avatar for BOINC@Poland 8. BOINC@Poland 3 pts. 30,156
  9. Avatar for VeFold 9. VeFold 1 pt. 30,049
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 28,773
  1. Avatar for BootsMcGraw 31. BootsMcGraw Lv 1 12 pts. 30,401
  2. Avatar for maithra 32. maithra Lv 1 11 pts. 30,382
  3. Avatar for Idiotboy 33. Idiotboy Lv 1 10 pts. 30,367
  4. Avatar for georg137 34. georg137 Lv 1 9 pts. 30,364
  5. Avatar for RichGuilmain 35. RichGuilmain Lv 1 8 pts. 30,323
  6. Avatar for roarshock 36. roarshock Lv 1 8 pts. 30,313
  7. Avatar for Tehnologik1 37. Tehnologik1 Lv 1 7 pts. 30,305
  8. Avatar for hansvandenhof 38. hansvandenhof Lv 1 6 pts. 30,229
  9. Avatar for ShadowTactics 39. ShadowTactics Lv 1 6 pts. 30,156
  10. Avatar for Trajan464 40. Trajan464 Lv 1 5 pts. 30,119

Comments