Placeholder image of a protein
Icon representing a puzzle

2293: Electron Density Reconstruction 37

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
April 21, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This one has two copies of the same protein in it.

Sequence
CSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNE SLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGF

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 31,503
  2. Avatar for Go Science 2. Go Science 68 pts. 31,371
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 31,135
  4. Avatar for Contenders 4. Contenders 27 pts. 31,115
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 31,044
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 30,998
  7. Avatar for Australia 7. Australia 5 pts. 30,581
  8. Avatar for BOINC@Poland 8. BOINC@Poland 3 pts. 30,156
  9. Avatar for VeFold 9. VeFold 1 pt. 30,049
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 28,773
  1. Avatar for abiogenesis 51. abiogenesis Lv 1 2 pts. 29,648
  2. Avatar for Oransche 52. Oransche Lv 1 2 pts. 29,599
  3. Avatar for Hillbillie 53. Hillbillie Lv 1 1 pt. 29,527
  4. Avatar for pfirth 54. pfirth Lv 1 1 pt. 29,438
  5. Avatar for rosie4loop 55. rosie4loop Lv 1 1 pt. 29,361
  6. Avatar for Merf 56. Merf Lv 1 1 pt. 29,241
  7. Avatar for carxo 57. carxo Lv 1 1 pt. 29,187
  8. Avatar for aku_sh33 58. aku_sh33 Lv 1 1 pt. 28,985
  9. Avatar for hada 59. hada Lv 1 1 pt. 28,940
  10. Avatar for Dr.Sillem 60. Dr.Sillem Lv 1 1 pt. 28,869

Comments