Placeholder image of a protein
Icon representing a puzzle

2293: Electron Density Reconstruction 37

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
April 21, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This one has two copies of the same protein in it.

Sequence
CSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNE SLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGF

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 31,503
  2. Avatar for Go Science 2. Go Science 68 pts. 31,371
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 31,135
  4. Avatar for Contenders 4. Contenders 27 pts. 31,115
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 31,044
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 30,998
  7. Avatar for Australia 7. Australia 5 pts. 30,581
  8. Avatar for BOINC@Poland 8. BOINC@Poland 3 pts. 30,156
  9. Avatar for VeFold 9. VeFold 1 pt. 30,049
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 28,773
  1. Avatar for Belle36 61. Belle36 Lv 1 1 pt. 28,861
  2. Avatar for rinze 62. rinze Lv 1 1 pt. 28,819
  3. Avatar for Mohoernchen 63. Mohoernchen Lv 1 1 pt. 28,816
  4. Avatar for JJ38000 64. JJ38000 Lv 1 1 pt. 28,803
  5. Avatar for zuzkos 65. zuzkos Lv 1 1 pt. 28,777
  6. Avatar for alyssa_d_V2.0 66. alyssa_d_V2.0 Lv 1 1 pt. 28,773
  7. Avatar for Larini 67. Larini Lv 1 1 pt. 28,750
  8. Avatar for Savas 68. Savas Lv 1 1 pt. 28,685
  9. Avatar for DScott 69. DScott Lv 1 1 pt. 28,629
  10. Avatar for Arne Heessels 70. Arne Heessels Lv 1 1 pt. 28,629

Comments