Icon representing a puzzle

Beginner Puzzle: Easy Mini Freestyle

Closed since over 2 years ago

Beginner

Summary

Created
May 01, 2023
Expires
Max points
100
Description

We are giving you this currently unsolved short protein as an extended chain. It has only 48 residues and we're posting it with no secondary structure predictions. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
STMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 8,163
  2. Avatar for Villanova ChE 2. Villanova ChE 24 pts. 7,239
  3. Avatar for DSN @ Home 3. DSN @ Home 4 pts. 6,512
  4. Avatar for SHELL 4. SHELL 1 pt. 6,469
  5. Avatar for CH4110 Fold it! 5. CH4110 Fold it! 1 pt. 6,231
  1. Avatar for JJ38000 11. JJ38000 Lv 1 35 pts. 7,587
  2. Avatar for Just_A_Nerd 12. Just_A_Nerd Lv 1 31 pts. 7,547
  3. Avatar for EtherealSun 13. EtherealSun Lv 1 27 pts. 7,547
  4. Avatar for gwlagerweij 14. gwlagerweij Lv 1 24 pts. 7,488
  5. Avatar for Quantum9356 15. Quantum9356 Lv 1 21 pts. 7,399
  6. Avatar for Jaylenstone 16. Jaylenstone Lv 1 19 pts. 7,239
  7. Avatar for CDSoffice 17. CDSoffice Lv 1 16 pts. 7,122
  8. Avatar for ivwaurt 18. ivwaurt Lv 1 14 pts. 7,063
  9. Avatar for Carnavious 19. Carnavious Lv 1 12 pts. 6,956
  10. Avatar for huikki 20. huikki Lv 1 11 pts. 6,512

Comments