Beginner Puzzle: Easy Mini Freestyle
Closed since almost 3 years ago
BeginnerSummary
- Created
- May 01, 2023
- Expires
- Max points
- 100
We are giving you this currently unsolved short protein as an extended chain. It has only 48 residues and we're posting it with no secondary structure predictions. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.
- Sequence
- STMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK