Icon representing a puzzle

Beginner Puzzle: Easy Mini Freestyle

Closed since almost 3 years ago

Beginner Beginner Beginner Beginner Beginner Beginner

Summary

Created
May 01, 2023
Expires
Max points
100
Description

We are giving you this currently unsolved short protein as an extended chain. It has only 48 residues and we're posting it with no secondary structure predictions. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
STMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 8,163
  2. Avatar for Villanova ChE 2. Villanova ChE 24 pts. 7,239
  3. Avatar for DSN @ Home 3. DSN @ Home 4 pts. 6,512
  4. Avatar for SHELL 4. SHELL 1 pt. 6,469
  5. Avatar for CH4110 Fold it! 5. CH4110 Fold it! 1 pt. 6,231
  1. Avatar for U202243007 51. U202243007 Lv 1 1 pt. 0
  2. Avatar for monkey 52. monkey Lv 1 1 pt. 0
  3. Avatar for HR 53. HR Lv 1 1 pt. 0

Comments