Icon representing a puzzle

Beginner Puzzle: Easy Mini Freestyle

Closed since almost 3 years ago

Beginner

Summary

Created
May 01, 2023
Expires
Max points
100
Description

We are giving you this currently unsolved short protein as an extended chain. It has only 48 residues and we're posting it with no secondary structure predictions. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
STMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 8,163
  2. Avatar for Villanova ChE 2. Villanova ChE 24 pts. 7,239
  3. Avatar for DSN @ Home 3. DSN @ Home 4 pts. 6,512
  4. Avatar for SHELL 4. SHELL 1 pt. 6,469
  5. Avatar for CH4110 Fold it! 5. CH4110 Fold it! 1 pt. 6,231
  1. Avatar for U202242698 21. U202242698 Lv 1 9 pts. 6,469
  2. Avatar for U202240756 22. U202240756 Lv 1 8 pts. 6,371
  3. Avatar for juasch 23. juasch Lv 1 7 pts. 6,300
  4. Avatar for duncan_m 24. duncan_m Lv 1 6 pts. 6,290
  5. Avatar for U202242494 25. U202242494 Lv 1 5 pts. 6,258
  6. Avatar for U202141951 26. U202141951 Lv 1 4 pts. 6,235
  7. Avatar for Deleted player 27. Deleted player 4 pts. 6,234
  8. Avatar for DiBSop2023 28. DiBSop2023 Lv 1 3 pts. 6,231
  9. Avatar for L.M.G. 29. L.M.G. Lv 1 3 pts. 6,221
  10. Avatar for U202143311 30. U202143311 Lv 1 2 pts. 6,216

Comments