Placeholder image of a protein
Icon representing a puzzle

2300: Electron Density Reconstruction 39

Closed since about 3 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
May 08, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
GSHMLPDSDVKQALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYAR

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 15,063
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 14,862
  3. Avatar for SHELL 13. SHELL 1 pt. 14,811

  1. Avatar for NinjaGreg 11. NinjaGreg Lv 1 50 pts. 15,649
  2. Avatar for guineapig 12. guineapig Lv 1 47 pts. 15,649
  3. Avatar for Punzi Baker 3 13. Punzi Baker 3 Lv 1 43 pts. 15,644
  4. Avatar for Bletchley Park 14. Bletchley Park Lv 1 40 pts. 15,643
  5. Avatar for ZeroLeak7 15. ZeroLeak7 Lv 1 37 pts. 15,638
  6. Avatar for maithra 16. maithra Lv 1 34 pts. 15,636
  7. Avatar for akaaka 17. akaaka Lv 1 32 pts. 15,633
  8. Avatar for MicElephant 18. MicElephant Lv 1 29 pts. 15,631
  9. Avatar for drjr 19. drjr Lv 1 27 pts. 15,630
  10. Avatar for gmn 20. gmn Lv 1 25 pts. 15,629

Comments