Placeholder image of a protein
Icon representing a puzzle

2300: Electron Density Reconstruction 39

Closed since about 3 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
May 08, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
GSHMLPDSDVKQALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYAR

Top groups


  1. Avatar for Go Science 100 pts. 15,669
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 15,665
  3. Avatar for Marvin's bunch 3. Marvin's bunch 41 pts. 15,652
  4. Avatar for Contenders 4. Contenders 24 pts. 15,649
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 14 pts. 15,627
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 15,543
  7. Avatar for Australia 7. Australia 4 pts. 15,401
  8. Avatar for BOINC@Poland 8. BOINC@Poland 2 pts. 15,343
  9. Avatar for VeFold 9. VeFold 1 pt. 15,223
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 15,118

  1. Avatar for NinjaGreg 11. NinjaGreg Lv 1 50 pts. 15,649
  2. Avatar for guineapig 12. guineapig Lv 1 47 pts. 15,649
  3. Avatar for Punzi Baker 3 13. Punzi Baker 3 Lv 1 43 pts. 15,644
  4. Avatar for Bletchley Park 14. Bletchley Park Lv 1 40 pts. 15,643
  5. Avatar for ZeroLeak7 15. ZeroLeak7 Lv 1 37 pts. 15,638
  6. Avatar for maithra 16. maithra Lv 1 34 pts. 15,636
  7. Avatar for akaaka 17. akaaka Lv 1 32 pts. 15,633
  8. Avatar for MicElephant 18. MicElephant Lv 1 29 pts. 15,631
  9. Avatar for drjr 19. drjr Lv 1 27 pts. 15,630
  10. Avatar for gmn 20. gmn Lv 1 25 pts. 15,629

Comments