Placeholder image of a protein
Icon representing a puzzle

2300: Electron Density Reconstruction 39

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
May 08, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
GSHMLPDSDVKQALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYAR

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 15,063
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 14,862
  3. Avatar for SHELL 13. SHELL 1 pt. 14,811
  1. Avatar for Flagg65a 31. Flagg65a Lv 1 9 pts. 15,476
  2. Avatar for Trajan464 32. Trajan464 Lv 1 8 pts. 15,467
  3. Avatar for NPrincipi 33. NPrincipi Lv 1 7 pts. 15,424
  4. Avatar for alcor29 34. alcor29 Lv 1 7 pts. 15,416
  5. Avatar for AlkiP0Ps 35. AlkiP0Ps Lv 1 6 pts. 15,401
  6. Avatar for hansvandenhof 36. hansvandenhof Lv 1 5 pts. 15,361
  7. Avatar for hada 37. hada Lv 1 5 pts. 15,345
  8. Avatar for Altercomp 38. Altercomp Lv 1 4 pts. 15,345
  9. Avatar for ShadowTactics 39. ShadowTactics Lv 1 4 pts. 15,343
  10. Avatar for RichGuilmain 40. RichGuilmain Lv 1 3 pts. 15,307

Comments