Placeholder image of a protein
Icon representing a puzzle

2300: Electron Density Reconstruction 39

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
May 08, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
GSHMLPDSDVKQALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYAR

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 15,669
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 15,665
  3. Avatar for Marvin's bunch 3. Marvin's bunch 41 pts. 15,652
  4. Avatar for Contenders 4. Contenders 24 pts. 15,649
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 14 pts. 15,627
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 15,543
  7. Avatar for Australia 7. Australia 4 pts. 15,401
  8. Avatar for BOINC@Poland 8. BOINC@Poland 2 pts. 15,343
  9. Avatar for VeFold 9. VeFold 1 pt. 15,223
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 15,118
  1. Avatar for Flagg65a 31. Flagg65a Lv 1 9 pts. 15,476
  2. Avatar for Trajan464 32. Trajan464 Lv 1 8 pts. 15,467
  3. Avatar for NPrincipi 33. NPrincipi Lv 1 7 pts. 15,424
  4. Avatar for alcor29 34. alcor29 Lv 1 7 pts. 15,416
  5. Avatar for AlkiP0Ps 35. AlkiP0Ps Lv 1 6 pts. 15,401
  6. Avatar for hansvandenhof 36. hansvandenhof Lv 1 5 pts. 15,361
  7. Avatar for hada 37. hada Lv 1 5 pts. 15,345
  8. Avatar for Altercomp 38. Altercomp Lv 1 4 pts. 15,345
  9. Avatar for ShadowTactics 39. ShadowTactics Lv 1 4 pts. 15,343
  10. Avatar for RichGuilmain 40. RichGuilmain Lv 1 3 pts. 15,307

Comments