Placeholder image of a protein
Icon representing a puzzle

2300: Electron Density Reconstruction 39

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
May 08, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
GSHMLPDSDVKQALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYAR

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 15,063
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 14,862
  3. Avatar for SHELL 13. SHELL 1 pt. 14,811
  1. Avatar for Tehnologik1 41. Tehnologik1 Lv 1 3 pts. 15,301
  2. Avatar for Oransche 42. Oransche Lv 1 3 pts. 15,298
  3. Avatar for Wiz kid 43. Wiz kid Lv 1 2 pts. 15,244
  4. Avatar for Alistair69 44. Alistair69 Lv 1 2 pts. 15,240
  5. Avatar for zbp 45. zbp Lv 1 2 pts. 15,227
  6. Avatar for kitsoune 46. kitsoune Lv 1 2 pts. 15,223
  7. Avatar for ProfVince 47. ProfVince Lv 1 2 pts. 15,222
  8. Avatar for jausmh 48. jausmh Lv 1 1 pt. 15,203
  9. Avatar for Vinara 49. Vinara Lv 1 1 pt. 15,183
  10. Avatar for WhiteOwl000 50. WhiteOwl000 Lv 1 1 pt. 15,178

Comments