Placeholder image of a protein
Icon representing a puzzle

2300: Electron Density Reconstruction 39

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
May 08, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
GSHMLPDSDVKQALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYAR

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 15,669
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 15,665
  3. Avatar for Marvin's bunch 3. Marvin's bunch 41 pts. 15,652
  4. Avatar for Contenders 4. Contenders 24 pts. 15,649
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 14 pts. 15,627
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 15,543
  7. Avatar for Australia 7. Australia 4 pts. 15,401
  8. Avatar for BOINC@Poland 8. BOINC@Poland 2 pts. 15,343
  9. Avatar for VeFold 9. VeFold 1 pt. 15,223
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 15,118
  1. Avatar for Tehnologik1 41. Tehnologik1 Lv 1 3 pts. 15,301
  2. Avatar for Oransche 42. Oransche Lv 1 3 pts. 15,298
  3. Avatar for Wiz kid 43. Wiz kid Lv 1 2 pts. 15,244
  4. Avatar for Alistair69 44. Alistair69 Lv 1 2 pts. 15,240
  5. Avatar for zbp 45. zbp Lv 1 2 pts. 15,227
  6. Avatar for kitsoune 46. kitsoune Lv 1 2 pts. 15,223
  7. Avatar for ProfVince 47. ProfVince Lv 1 2 pts. 15,222
  8. Avatar for jausmh 48. jausmh Lv 1 1 pt. 15,203
  9. Avatar for Vinara 49. Vinara Lv 1 1 pt. 15,183
  10. Avatar for WhiteOwl000 50. WhiteOwl000 Lv 1 1 pt. 15,178

Comments