Placeholder image of a protein
Icon representing a puzzle

2300: Electron Density Reconstruction 39

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
May 08, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
GSHMLPDSDVKQALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYAR

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 15,063
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 14,862
  3. Avatar for SHELL 13. SHELL 1 pt. 14,811
  1. Avatar for pfirth 61. pfirth Lv 1 1 pt. 14,992
  2. Avatar for Mohoernchen 62. Mohoernchen Lv 1 1 pt. 14,951
  3. Avatar for froschi2 63. froschi2 Lv 1 1 pt. 14,902
  4. Avatar for illex 64. illex Lv 1 1 pt. 14,890
  5. Avatar for Sharkbait911 65. Sharkbait911 Lv 1 1 pt. 14,886
  6. Avatar for Deleted player 66. Deleted player 1 pt. 14,870
  7. Avatar for furi0us 67. furi0us Lv 1 1 pt. 14,862
  8. Avatar for Sammy3c2b1a0 68. Sammy3c2b1a0 Lv 1 1 pt. 14,862
  9. Avatar for Swapper242 69. Swapper242 Lv 1 1 pt. 14,859
  10. Avatar for U202143311 70. U202143311 Lv 1 1 pt. 14,811

Comments