Placeholder image of a protein
Icon representing a puzzle

2300: Electron Density Reconstruction 39

Closed since about 3 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
May 08, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
GSHMLPDSDVKQALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYAR

Top groups


  1. Avatar for Go Science 100 pts. 15,669
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 15,665
  3. Avatar for Marvin's bunch 3. Marvin's bunch 41 pts. 15,652
  4. Avatar for Contenders 4. Contenders 24 pts. 15,649
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 14 pts. 15,627
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 15,543
  7. Avatar for Australia 7. Australia 4 pts. 15,401
  8. Avatar for BOINC@Poland 8. BOINC@Poland 2 pts. 15,343
  9. Avatar for VeFold 9. VeFold 1 pt. 15,223
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 15,118

  1. Avatar for pfirth 61. pfirth Lv 1 1 pt. 14,992
  2. Avatar for Mohoernchen 62. Mohoernchen Lv 1 1 pt. 14,951
  3. Avatar for froschi2 63. froschi2 Lv 1 1 pt. 14,902
  4. Avatar for illex 64. illex Lv 1 1 pt. 14,890
  5. Avatar for Sharkbait911 65. Sharkbait911 Lv 1 1 pt. 14,886
  6. Avatar for Deleted player 66. Deleted player 1 pt. 14,870
  7. Avatar for furi0us 67. furi0us Lv 1 1 pt. 14,862
  8. Avatar for Sammy3c2b1a0 68. Sammy3c2b1a0 Lv 1 1 pt. 14,862
  9. Avatar for Swapper242 69. Swapper242 Lv 1 1 pt. 14,859
  10. Avatar for U202143311 70. U202143311 Lv 1 1 pt. 14,811

Comments