Placeholder image of a protein
Icon representing a puzzle

2303: Electron Density Reconstruction 40

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
May 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. The individual chains in this protein have the same sequence.

Sequence
RMKQLEDKVEELLSKAYHLENEVARLKKLVGER

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 23,551
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 23,549
  3. Avatar for Contenders 3. Contenders 47 pts. 23,524
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 23,499
  5. Avatar for Australia 5. Australia 19 pts. 23,481
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 23,435
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 7 pts. 23,434
  8. Avatar for BOINC@Poland 8. BOINC@Poland 4 pts. 23,296
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 2 pts. 23,222
  10. Avatar for VeFold 10. VeFold 1 pt. 23,087
  1. Avatar for BootsMcGraw 21. BootsMcGraw Lv 1 25 pts. 23,483
  2. Avatar for AlkiP0Ps 22. AlkiP0Ps Lv 1 23 pts. 23,481
  3. Avatar for phi16 23. phi16 Lv 1 21 pts. 23,478
  4. Avatar for Steven Pletsch 24. Steven Pletsch Lv 1 20 pts. 23,465
  5. Avatar for christioanchauvin 25. christioanchauvin Lv 1 18 pts. 23,435
  6. Avatar for WBarme1234 26. WBarme1234 Lv 1 17 pts. 23,434
  7. Avatar for akaaka 27. akaaka Lv 1 15 pts. 23,429
  8. Avatar for NPrincipi 28. NPrincipi Lv 1 14 pts. 23,417
  9. Avatar for equilibria 29. equilibria Lv 1 13 pts. 23,389
  10. Avatar for alcor29 30. alcor29 Lv 1 12 pts. 23,387

Comments

LociOiling Lv 1

This one is a good match for PDB 1RB4 and several others, but the PDB entries seem to missing the last two residues ("ER") we see in this puzzle.

WBarme1234 Lv 1

2 equal helics Only +3rd helic missing 2residues at beginning of sequence
rmkqledkveellskayhlenevarlkklvg
rmkqledkveellskayhlenevarlkklvg
__kqledkveellskayhlenevarlkklvg
LHHHHHHHHHHHHHHHHHHHHHHHHHHHHHL
LHHHHHHHHHHHHHHHHHHHHHHHHHHHHHL
__LHHHHHHHHHHHHHHHHHHHHHHHHHHHL