Placeholder image of a protein
Icon representing a puzzle

2303: Electron Density Reconstruction 40

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
May 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. The individual chains in this protein have the same sequence.

Sequence
RMKQLEDKVEELLSKAYHLENEVARLKKLVGER

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 23,551
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 23,549
  3. Avatar for Contenders 3. Contenders 47 pts. 23,524
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 23,499
  5. Avatar for Australia 5. Australia 19 pts. 23,481
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 23,435
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 7 pts. 23,434
  8. Avatar for BOINC@Poland 8. BOINC@Poland 4 pts. 23,296
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 2 pts. 23,222
  10. Avatar for VeFold 10. VeFold 1 pt. 23,087
  1. Avatar for NickMihal 61. NickMihal Lv 1 1 pt. 23,032
  2. Avatar for Dr.Sillem 62. Dr.Sillem Lv 1 1 pt. 23,031
  3. Avatar for furi0us 63. furi0us Lv 1 1 pt. 23,014
  4. Avatar for rinze 64. rinze Lv 1 1 pt. 23,002
  5. Avatar for pruneau_44 65. pruneau_44 Lv 1 1 pt. 23,001
  6. Avatar for Swapper242 66. Swapper242 Lv 1 1 pt. 22,992
  7. Avatar for brockmcneill 67. brockmcneill Lv 1 1 pt. 22,991
  8. Avatar for zbp 68. zbp Lv 1 1 pt. 22,991
  9. Avatar for ntippins 69. ntippins Lv 1 1 pt. 22,988
  10. Avatar for ennimoye5853 70. ennimoye5853 Lv 1 1 pt. 22,988

Comments

LociOiling Lv 1

This one is a good match for PDB 1RB4 and several others, but the PDB entries seem to missing the last two residues ("ER") we see in this puzzle.

WBarme1234 Lv 1

2 equal helics Only +3rd helic missing 2residues at beginning of sequence
rmkqledkveellskayhlenevarlkklvg
rmkqledkveellskayhlenevarlkklvg
__kqledkveellskayhlenevarlkklvg
LHHHHHHHHHHHHHHHHHHHHHHHHHHHHHL
LHHHHHHHHHHHHHHHHHHHHHHHHHHHHHL
__LHHHHHHHHHHHHHHHHHHHHHHHHHHHL