Placeholder image of a protein
Icon representing a puzzle

2303: Electron Density Reconstruction 40

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
May 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. The individual chains in this protein have the same sequence.

Sequence
RMKQLEDKVEELLSKAYHLENEVARLKKLVGER

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 23,551
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 23,549
  3. Avatar for Contenders 3. Contenders 47 pts. 23,524
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 23,499
  5. Avatar for Australia 5. Australia 19 pts. 23,481
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 23,435
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 7 pts. 23,434
  8. Avatar for BOINC@Poland 8. BOINC@Poland 4 pts. 23,296
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 2 pts. 23,222
  10. Avatar for VeFold 10. VeFold 1 pt. 23,087
  1. Avatar for Deleted player 51. Deleted player 1 pt. 23,122
  2. Avatar for abiogenesis 52. abiogenesis Lv 1 1 pt. 23,108
  3. Avatar for Larini 53. Larini Lv 1 1 pt. 23,091
  4. Avatar for carxo 54. carxo Lv 1 1 pt. 23,087
  5. Avatar for Altercomp 55. Altercomp Lv 1 1 pt. 23,068
  6. Avatar for Grbee 56. Grbee Lv 1 1 pt. 23,066
  7. Avatar for Speer 57. Speer Lv 1 1 pt. 23,056
  8. Avatar for DScott 58. DScott Lv 1 1 pt. 23,056
  9. Avatar for Mohoernchen 59. Mohoernchen Lv 1 1 pt. 23,042
  10. Avatar for Arne Heessels 60. Arne Heessels Lv 1 1 pt. 23,038

Comments

LociOiling Lv 1

This one is a good match for PDB 1RB4 and several others, but the PDB entries seem to missing the last two residues ("ER") we see in this puzzle.

WBarme1234 Lv 1

2 equal helics Only +3rd helic missing 2residues at beginning of sequence
rmkqledkveellskayhlenevarlkklvg
rmkqledkveellskayhlenevarlkklvg
__kqledkveellskayhlenevarlkklvg
LHHHHHHHHHHHHHHHHHHHHHHHHHHHHHL
LHHHHHHHHHHHHHHHHHHHHHHHHHHHHHL
__LHHHHHHHHHHHHHHHHHHHHHHHHHHHL