Placeholder image of a protein
Icon representing a puzzle

2321: Electron Density Reconstruction 46

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
June 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This structure has two copies in it.

Sequence
MDGVYVLSVKEDVPAAGILHAGDLITEIDGQSFKSSQEFIDYIHSKKVGDTVKIKYKHGNKNEEASIKLTAIDKKGTPGIGILEHHHHHH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 25,229
  2. Avatar for Go Science 2. Go Science 71 pts. 25,178
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 25,073
  4. Avatar for Contenders 4. Contenders 33 pts. 25,022
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 22 pts. 24,902
  6. Avatar for Australia 6. Australia 14 pts. 24,664
  7. Avatar for BOINC@Poland 7. BOINC@Poland 8 pts. 24,574
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 24,516
  9. Avatar for Gargleblasters 9. Gargleblasters 3 pts. 24,037
  10. Avatar for Void Crushers 10. Void Crushers 2 pts. 23,961
  1. Avatar for gmn 11. gmn Lv 1 52 pts. 25,048
  2. Avatar for Bruno Kestemont 12. Bruno Kestemont Lv 1 49 pts. 25,035
  3. Avatar for Bletchley Park 13. Bletchley Park Lv 1 45 pts. 25,022
  4. Avatar for Wanderer09 14. Wanderer09 Lv 1 42 pts. 25,016
  5. Avatar for Aubade01 15. Aubade01 Lv 1 39 pts. 24,978
  6. Avatar for g_b 16. g_b Lv 1 36 pts. 24,978
  7. Avatar for akaaka 17. akaaka Lv 1 34 pts. 24,924
  8. Avatar for WBarme1234 18. WBarme1234 Lv 1 31 pts. 24,902
  9. Avatar for MicElephant 19. MicElephant Lv 1 29 pts. 24,859
  10. Avatar for Steven Pletsch 20. Steven Pletsch Lv 1 27 pts. 24,845

Comments