Placeholder image of a protein
Icon representing a puzzle

2321: Electron Density Reconstruction 46

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
June 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This structure has two copies in it.

Sequence
MDGVYVLSVKEDVPAAGILHAGDLITEIDGQSFKSSQEFIDYIHSKKVGDTVKIKYKHGNKNEEASIKLTAIDKKGTPGIGILEHHHHHH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 25,229
  2. Avatar for Go Science 2. Go Science 71 pts. 25,178
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 25,073
  4. Avatar for Contenders 4. Contenders 33 pts. 25,022
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 22 pts. 24,902
  6. Avatar for Australia 6. Australia 14 pts. 24,664
  7. Avatar for BOINC@Poland 7. BOINC@Poland 8 pts. 24,574
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 24,516
  9. Avatar for Gargleblasters 9. Gargleblasters 3 pts. 24,037
  10. Avatar for Void Crushers 10. Void Crushers 2 pts. 23,961
  1. Avatar for Igba 51. Igba Lv 1 1 pt. 23,645
  2. Avatar for machinelves 52. machinelves Lv 1 1 pt. 23,628
  3. Avatar for pizpot 53. pizpot Lv 1 1 pt. 23,556
  4. Avatar for Merf 54. Merf Lv 1 1 pt. 23,414
  5. Avatar for frostschutz 55. frostschutz Lv 1 1 pt. 23,386
  6. Avatar for carxo 56. carxo Lv 1 1 pt. 23,359
  7. Avatar for Dr.Sillem 57. Dr.Sillem Lv 1 1 pt. 23,343
  8. Avatar for Casey Cramp 58. Casey Cramp Lv 1 1 pt. 23,270
  9. Avatar for pfirth 59. pfirth Lv 1 1 pt. 23,249
  10. Avatar for Arne Heessels 60. Arne Heessels Lv 1 1 pt. 23,222

Comments