Placeholder image of a protein
Icon representing a puzzle

2329: Electron Density Reconstruction 49

Closed since almost 3 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
July 12, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
APVRSLNCGLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 26,974
  2. Avatar for Go Science 2. Go Science 65 pts. 26,918
  3. Avatar for Contenders 3. Contenders 41 pts. 26,792
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 26,791
  5. Avatar for Gargleblasters 5. Gargleblasters 14 pts. 26,657
  6. Avatar for Marvin's bunch 6. Marvin's bunch 7 pts. 26,565
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 26,408
  8. Avatar for Australia 8. Australia 2 pts. 26,342
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 26,042
  10. Avatar for VeFold 10. VeFold 1 pt. 25,002

  1. Avatar for rezaefar 41. rezaefar Lv 1 1 pt. 25,588
  2. Avatar for Artoria2e5 42. Artoria2e5 Lv 1 1 pt. 25,552
  3. Avatar for Flagg65a 43. Flagg65a Lv 1 1 pt. 25,549
  4. Avatar for Oransche 44. Oransche Lv 1 1 pt. 25,507
  5. Avatar for Merf 45. Merf Lv 1 1 pt. 25,483
  6. Avatar for abiogenesis 46. abiogenesis Lv 1 1 pt. 25,426
  7. Avatar for fiendish_ghoul 47. fiendish_ghoul Lv 1 1 pt. 25,325
  8. Avatar for Alistair69 48. Alistair69 Lv 1 1 pt. 25,095
  9. Avatar for carxo 49. carxo Lv 1 1 pt. 25,002
  10. Avatar for CDSoffice 50. CDSoffice Lv 1 1 pt. 24,722

Comments