Placeholder image of a protein
Icon representing a puzzle

2329: Electron Density Reconstruction 49

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
July 12, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
APVRSLNCGLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 26,974
  2. Avatar for Go Science 2. Go Science 65 pts. 26,918
  3. Avatar for Contenders 3. Contenders 41 pts. 26,792
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 26,791
  5. Avatar for Gargleblasters 5. Gargleblasters 14 pts. 26,657
  6. Avatar for Marvin's bunch 6. Marvin's bunch 7 pts. 26,565
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 26,408
  8. Avatar for Australia 8. Australia 2 pts. 26,342
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 26,042
  10. Avatar for VeFold 10. VeFold 1 pt. 25,002
  1. Avatar for streakwind 61. streakwind Lv 1 1 pt. 23,327
  2. Avatar for Gematron 2874 62. Gematron 2874 Lv 1 1 pt. 19,663
  3. Avatar for apetrides 63. apetrides Lv 1 1 pt. 17,571
  4. Avatar for crabapple 64. crabapple Lv 1 1 pt. 17,571
  5. Avatar for klbklb 65. klbklb Lv 1 1 pt. 17,571
  6. Avatar for Gandalf2023 66. Gandalf2023 Lv 1 1 pt. 17,571

Comments