Placeholder image of a protein
Icon representing a puzzle

2329: Electron Density Reconstruction 49

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
July 12, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
APVRSLNCGLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 26,974
  2. Avatar for Go Science 2. Go Science 65 pts. 26,918
  3. Avatar for Contenders 3. Contenders 41 pts. 26,792
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 26,791
  5. Avatar for Gargleblasters 5. Gargleblasters 14 pts. 26,657
  6. Avatar for Marvin's bunch 6. Marvin's bunch 7 pts. 26,565
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 26,408
  8. Avatar for Australia 8. Australia 2 pts. 26,342
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 26,042
  10. Avatar for VeFold 10. VeFold 1 pt. 25,002
  1. Avatar for Dr.Sillem 51. Dr.Sillem Lv 1 1 pt. 24,665
  2. Avatar for rinze 52. rinze Lv 1 1 pt. 24,640
  3. Avatar for Mohoernchen 53. Mohoernchen Lv 1 1 pt. 24,639
  4. Avatar for Larini 54. Larini Lv 1 1 pt. 24,606
  5. Avatar for DScott 55. DScott Lv 1 1 pt. 24,600
  6. Avatar for AlphaFold2 56. AlphaFold2 Lv 1 1 pt. 24,562
  7. Avatar for pruneau_44 57. pruneau_44 Lv 1 1 pt. 24,552
  8. Avatar for dahast.de 58. dahast.de Lv 1 1 pt. 24,551
  9. Avatar for InternetPerson10 59. InternetPerson10 Lv 1 1 pt. 24,541
  10. Avatar for furi0us 60. furi0us Lv 1 1 pt. 24,097

Comments