Icon representing a puzzle

2352: Revisiting Puzzle 95: Chicken

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 16, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,849
  2. Avatar for Go Science 2. Go Science 71 pts. 10,746
  3. Avatar for Contenders 3. Contenders 49 pts. 10,663
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 10,658
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 10,596
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 10,383
  7. Avatar for VeFold 7. VeFold 8 pts. 10,340
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 5 pts. 10,230
  9. Avatar for BOINC@Poland 9. BOINC@Poland 3 pts. 10,117
  10. Avatar for Australia 10. Australia 2 pts. 10,037

  1. Avatar for g_b 21. g_b Lv 1 30 pts. 10,451
  2. Avatar for jausmh 22. jausmh Lv 1 28 pts. 10,441
  3. Avatar for Simek 23. Simek Lv 1 26 pts. 10,383
  4. Avatar for roarshock 24. roarshock Lv 1 24 pts. 10,345
  5. Avatar for Hillbillie 25. Hillbillie Lv 1 23 pts. 10,340
  6. Avatar for alcor29 26. alcor29 Lv 1 21 pts. 10,334
  7. Avatar for Calimero Sombrero 27. Calimero Sombrero Lv 1 20 pts. 10,305
  8. Avatar for Gonegirl 28. Gonegirl Lv 1 18 pts. 10,296
  9. Avatar for maithra 29. maithra Lv 1 17 pts. 10,287
  10. Avatar for MirsadaH 30. MirsadaH Lv 1 16 pts. 10,274

Comments