Icon representing a puzzle

2352: Revisiting Puzzle 95: Chicken

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
August 16, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,849
  2. Avatar for Go Science 2. Go Science 71 pts. 10,746
  3. Avatar for Contenders 3. Contenders 49 pts. 10,663
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 10,658
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 10,596
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 10,383
  7. Avatar for VeFold 7. VeFold 8 pts. 10,340
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 5 pts. 10,230
  9. Avatar for BOINC@Poland 9. BOINC@Poland 3 pts. 10,117
  10. Avatar for Australia 10. Australia 2 pts. 10,037
  1. Avatar for Deleted player 61. Deleted player 1 pt. 9,484
  2. Avatar for Diegogoogle 62. Diegogoogle Lv 1 1 pt. 9,460
  3. Avatar for shhie23 63. shhie23 Lv 1 1 pt. 9,457
  4. Avatar for amellen1 64. amellen1 Lv 1 1 pt. 9,450
  5. Avatar for rinze 65. rinze Lv 1 1 pt. 9,423
  6. Avatar for Yechan Kwon 66. Yechan Kwon Lv 1 1 pt. 9,409
  7. Avatar for harvardman 67. harvardman Lv 1 1 pt. 9,300
  8. Avatar for rezaefar 68. rezaefar Lv 1 1 pt. 9,275
  9. Avatar for Mohoernchen 69. Mohoernchen Lv 1 1 pt. 9,266
  10. Avatar for HavocOrder0999 70. HavocOrder0999 Lv 1 1 pt. 9,255

Comments